Target Details

ID:UAB_BIOLAB_trg0002
Name:Keratinase 1 - Ker1
Lab:BIOLAB: Department of Biology, University Abdelhamid Ibn Badis Mostaganem - UMAB, DZ
Date:2015-07-01
Organism:Bacillus pumilis
Status:Selected, Cloned, Expressed
URL:
Remarks:
Mutation:
    Sequence:
      MCVKKKNVMTSVLLAVPLLFSAGFGGSIANAETASKSESEKSYIVGFKASATTNSSKKQA
      VTQNGGKLEKQYRLINAAQVKMSEQAAKKLEHDPSIAYVEEDHKAEAYAQTVPYGIPQIK
      APAVHAQGYKGANVKVAVLDTGIHAAHPDLNVAGGASFVPSEPNATQDFQSHGTHVAGTI
      AALDNTIGVLGVAPSASLYAVKVLDRYGDGQYSWIISGIEWAVANNMDVINMSLGGPNGS
      TALKNAVDTANNRGVVVVAAAGNSGSTGSTSTVGYPAKYDSTIAVANVNSNNVRNSSSSA
      GPELDVSAPGTSILSTVPSSGYTSYTGTSMASPHVAGAAALILSKYPNLSTSQVRQRLEN
      TATPLGNSFYYGKGLINVQAAS