Target Details

ID:UAB_BIOLAB_trg0003
Name:Keratinase 2 - Ker2
Lab:BIOLAB: Department of Biology, University Abdelhamid Ibn Badis Mostaganem - UMAB, DZ
Date:2015-07-01
Organism:Bacillus pumilis
Status:Selected, Cloned, Expressed
URL:
Remarks:This sequnece align 100% with serine alkaline protease in http://www.ncbi.nlm.nih.gov/nuccore/460147498
Mutation:
    Sequence:
      MKGRVGIVKVKSFGAGLCMASMLLASMTFGASDVSAKDQAKKEYMIGFSSSVQDKTQKQL
      VEKAGGHVKESIEKIDMMKVSLNEASKEKLHQAKEVTFIEEDQKAKTSGQSVPYGIKSIK
      AQKVHKRGYAGQNVKVAVLDSGIDGKHEDLHVTGGVSFVPTESDPLVDPHEHGTHVAGTI
      AALDNKVGVVGVAPKASIYAVKVADENGDGYYSWIIKGIEWAIENEMDVINISMGGASES
      EALKEAVDRAYDNGILIVASAGNAGSYGSLNTIDYPAKYSSVMAVASVDQRKQRAFDSSV
      GEEVEVSAPGVSTLSTIPHNEYGYKSGTSMASPHVAGAAAVILSKHPNLTNDELRERLTK
      TATKL