Target Details

ID:UCT_DMBZMG_trg0032
Name:Angiotensin-I Converting Enzyme in complex with BRADYKININ-POTENTIATING Peptide b (BPPb)
Lab:DMBZMG: Zinc Metalloprotease Group, Division of Medical Biochemistry, Institute of Infectious Disease and Molecular Medicine, UCT, SA
Date:2011-09-14
Organism:Homo sapiens
Status:
URL:
Remarks:Starts at L37 (L642/UniProt). Residues 37-39, 435-438 and 625 are not observed in E-Density map. In collaboration with Department of Biology and Biochemistry, University of Bath, UK
Mutation:
    Sequence:
      LVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYG
      TQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNG
      SCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDA
      GDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLG
      NMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFW
      NKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKD
      LPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIA
      FIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPS
      SVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPE
      AMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNS

      Target domain composition and function

      There are no domain definitions in CATH or SCOP for this target.

      The following are alignment based Predicted Structural Domains and Function:
      Domain(s)FunctionSeq.Identity
    • DMs_ :