Target Details

ID:UCT_DMBZMG_trg0033
Name:Angiotensin-I Converting Enzyme in complex with Angiotensin-II
Lab:DMBZMG: Zinc Metalloprotease Group, Division of Medical Biochemistry, Institute of Infectious Disease and Molecular Medicine, UCT, SA
Date:2011-07-14
Organism:Drosophila melanogaster (fruit fly)
DBase Refs:
DBname:uniprotDBid:Q10714
DBname:pdbDBid:4aa1
Status:Selected, Cloned, Expressed, Soluble, Purified, Crystallized, Diffraction-quality Crystals, Diffraction, Crystal Structure, In PDB
URL:
Remarks:Starts at A17 (A17/UniProt). In collaboration with Department of Biology and Biochemistry, University of Bath, UK
Mutation:
    Sequence:
      ALVKEEIQAKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEV
      ASDTTKFQWRSYQSEDLKRQFKALTKLGYAALPEDDYAELLDTLSAMESNFAKVKVCDYK
      DSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNN
      FTSGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPM
      HLLGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQGYTPLKMFQMGDDFFTSMNLTKLP
      QDFWDKSIIEKPTDGRDLVCHASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFL
      QYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVRDDEARINQLFLTAL
      DKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKY
      HISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSAAAGAAFHNML
      SMGASKPWPDALEAFNGERIMSGKAIAEYFEPLRVWLEAENIKNNVHIGWTTSNKCVS

      Ligands Site Exploration
    • 4AA1
    • Structural Domains(for details, click on SCOP & CATH coloured regions)