Target Details

ID:UCT_DMBZMG_trg0039
Name:Testicular Angiotensin-I Converting Enzyme mutant R522K in complex with captopril
Lab:DMBZMG: Zinc Metalloprotease Group, Division of Medical Biochemistry, Institute of Infectious Disease and Molecular Medicine, UCT, SA
Date:2011-01-01
Organism:Homo sapiens
Status:
URL:
Remarks:Starts at L37 (L642/UniProt), Residues 37-39 and 435-438 not observed in ED-map. In collaboration with Department of Biology and Biochemistry, University of Bath, UK
Mutation:
    R522K
    Sequence:
      LVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYG
      TQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNG
      SCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDA
      GDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLG
      NMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFW
      NKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKD
      LPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIA
      FIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPS
      SVPYIKYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPW
      PEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNS

      Target domain composition and function

      There are no domain definitions in CATH or SCOP for this target.

      The following are alignment based Predicted Structural Domains and Function:
      Domain(s)FunctionSeq.Identity
    • DMs_ :