Target Details

ID:UCT_DMBZMG_trg0043
Name:Angiotensin-I Converting Enzyme (ANCE) in complex with a phosphinic tripeptide FI
Lab:DMBZMG: Zinc Metalloprotease Group, Division of Medical Biochemistry, Institute of Infectious Disease and Molecular Medicine, UCT, SA
Date:2012-07-14
Organism:Drosophila melanogaster (fruit fly)
Status:
URL:
Remarks:Starts at A17 (A17/UniProt). Residues 17-18 are not observed in ED-map. In collaboration with Department of Biology and Biochemistry, University of Bath, UK
Mutation:
    Sequence:
      ALVKEEIQAKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEV
      ASDTTKFQWRSYQSEDLKRQFKALTKLGYAALPEDDYAELLDTLSAMESNFAKVKVCDYK
      DSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNN
      FTSGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPM
      HLLGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQGYTPLKMFQMGDDFFTSMNLTKLP
      QDFWDKSIIEKPTDGRDLVCHASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFL
      QYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVRDDEARINQLFLTAL
      DKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKY
      HISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSAAAGAAFHNML
      SMGASKPWPDALEAFNGERIMSGKAIAEYFEPLRVWLEAENIKNNVHIGWTTSNKCVS

      Target domain composition and function

      There are no domain definitions in CATH or SCOP for this target.

      The following are alignment based Predicted Structural Domains and Function:
      Domain(s)FunctionSeq.Identity
    • DMs_ :