Target Details

ID:UCT_EMUSBG_trg0038
Name:1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase
Lab:EMUSBG: Structural Biology Group, Electron Microscope Unit, Institute of Infectious Disease and Molecular Medicine, UCT, SA
Date:2011-03-01
Organism:Mycobacterium Tuberculosis
DBase Refs:
DBname:uniprotDBid:O50426
DBname:pdbDBid:4ewl
Status:Selected, Cloned, Expressed, Soluble, Purified, Crystallized, Diffraction-quality Crystals, Diffraction, Crystal Structure, In PDB
URL:
Remarks:
Mutation:
    Sequence:
      MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADH
      ADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGA
      LVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKF
      YWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAA
      LAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFT

      Ligands Site Exploration
    • 4EWL
    • Target domain composition and function

      There are no domain definitions in CATH or SCOP for the PDB id: 4ewl.

      The following are alignment based Predicted Structural Domains and Function:
      Domain(s)FunctionSeq.Identity