Target Details

ID:UCT_EMUSBG_trg0040
Name:E142L mutant Amidase
Lab:EMUSBG: Structural Biology Group, Electron Microscope Unit, Institute of Infectious Disease and Molecular Medicine, UCT, SA
Date:2012-05-01
Organism:Geobacillus pallidus
Status:
URL:
Remarks:Residues 340-348 (EGKTKEIGV at the C-terminal ) are not observed for missing E-Density.
Mutation:
    E142L
    Sequence:
      MRHGDISSSHDTVGIAVVNYKMPRLHTKAEVIENAKKIADMVVGMKQGLPGMDLVVFPEY
      STMGIMYDQDEMFATAASIPGEETAIFAEACKKADTWGVFSLTGEKHEDHPNKAPYNTLV
      LINNKGEIVQKYRKIIPWCPILGWYPGDTTYVTEGPKGLKISLIVCDDGNYPEIWRDC
      AMKGAELIVRCQGYMYPAKEQQIMMAKAMAWANNTYVAVANATGFDGVYSYFGHSAIIGF
      DGRTLGECGTEENGIQYAEVSISQIRDFRKNAQSQNHLFKLLHRGYTGLINSGEGDRGVA
      ECPFDFYRTWVLDAEKARENVEKITRSTVGTAECPIQGIPNEGKTKEIGV

      Target domain composition and function

      There are no domain definitions in CATH or SCOP for this target.

      The following are alignment based Predicted Structural Domains and Function:
      Domain(s)FunctionSeq.Identity
    • DMs_ :