Target Details

ID:UCT_EMUSBG_trg0042
Name:C145A mutant Amidase in complex with butyramide
Lab:EMUSBG: Structural Biology Group, Electron Microscope Unit, Institute of Infectious Disease and Molecular Medicine, UCT, SA
Date:2013-05-01
Organism:Nesterenkonia sp. AN1 (sp. 10004)
Status:
URL:
Remarks:Residues 238-247 (DQSQDAGSDS near the C-terminal ) are not observed for missing E-Density.
Mutation:
    C145A
    Sequence:
      MGSSHHHHHHSSGLVPRGSHMRIALMQHTARPLDPQHNLDLIDDAAARASEQGAQLLLTP
      ELFGFGYVPSQICAQVSAEQVDAARSRLRGIARDRGIALVWSLPGPEGPEQRGITAELAD
      EHGEVLASYQKVQLYGPEEKAAFVPGEQPPPVLSWGGRQLSLLVAYDVEFPEMVRAAA
      ARGAQLVLVPTALAGDETSVPGILLPARAVENGITLAYANHCGPEGGLVFDGGSVVVGPA
      GQPLGELGVEPGLLVVDLPDQSQDAGSDSADYLQDRRAELHRNWL

      Target domain composition and function

      There are no domain definitions in CATH or SCOP for this target.

      The following are alignment based Predicted Structural Domains and Function:
      Domain(s)FunctionSeq.Identity
    • DMs_ :