Target Details

ID:WITS_PSFRU-GCJ_trg0022
Name:Human CLIC1, E81M mutant
Lab:Protein Structure and Function Research Unit, School of Molecular and Cell Biology, WITS, SA
Date:2010-06-15
Organism:Homo Sapien
Status:
URL:
Remarks:Expressed and purified as a recombinant protein in E. coli., Chain A lacks residues 1-3 and residues 153-159 and chain B lacks residues 1-5 and residues 238-241 as they lack Elecron-Density Map.
Mutation:
    E81M
    Sequence:
      MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCP
      GGQLPFLLYGTEVHTDTNKIMEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYI
      KNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADC
      NLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAK
      ALK

      Target domain composition and function

      There are no domain definitions in CATH or SCOP for this target.

      The following are alignment based Predicted Structural Domains and Function:
      Domain(s)FunctionSeq.Identity
    • DMs_ :