Target Details

ID:WITS_PSFRU-GCJ_trg0024
Name:Human GSTA1-1, L23A mutant
Lab:Protein Structure and Function Research Unit, School of Molecular and Cell Biology, WITS, SA
Date:2010-10-10
Organism:Homo Sapien
Status:
URL:
Remarks:Expressed and purified as a recombinant protein in E. coli.
Mutation:
    L23A
    Sequence:
      MAEKPKLHYFNARGRMESTRWALAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMV
      EIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKD
      AKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSF
      PLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF

      Target domain composition and function

      There are no domain definitions in CATH or SCOP for this target.

      The following are alignment based Predicted Structural Domains and Function:
      Domain(s)FunctionSeq.Identity
    • DMs_ :