Target Details

ID:WITS_PSFRU-GCJ_trg0029
Name:Human-GSTA1-1-I75A: Glutathione Transferase A1-1
Lab:Protein Structure and Function Research Unit, School of Molecular and Cell Biology, WITS, SA
Date:2011-08-01
Organism:Homo Sapien
Status:
URL:http://web.wits.ac.za/Academic/Science/mcb/protein/
Remarks:This is a mutant target; Ile(75) to Ala(75), recombinantly expressed in E.coli. Residues 1 and 201-222 not observed in Electron Density Map. The uniprot P08263 identifier is for the wild type protein
Mutation:
    I75A
    Sequence:
      MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
      DGMKLVQTRAILNYAASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKD
      AKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSF
      PLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF

      Target domain composition and function

      There are no domain definitions in CATH or SCOP for this target.

      The following are alignment based Predicted Structural Domains and Function:
      Domain(s)FunctionSeq.Identity
    • DMs_ :