Target Details

ID:WITS_PSFRU-HIV_trg0001
Name:HIV-1 south african subtype C protease wild type
Lab:HIV Research Thrust in Protein Structure and Function Research Unit, School of Molecular and Cell Biology, WITS, SA
Date:2008-08-01
Organism:Human immunodeficiency virus 1 (HIV-1)
Status:
URL:
Remarks:Wild type sequence with a discripency between UniProt sequence (Q98X61) and the sequence of this entry where UniProt has Q7 and this entry has K7. The viral protease is over-expressed and purified from E. coli bacterial cells.
Mutation:
    Sequence:
      PQITLWKRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
      QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

      Target domain composition and function

      There are no domain definitions in CATH or SCOP for this target.

      The following are alignment based Predicted Structural Domains and Function:
      Domain(s)FunctionSeq.Identity
    • DMs_ :